General Information

  • ID:  hor006541
  • Uniprot ID:  P45652
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Haplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Expressed only in the terminal nerve nucleus of the telencephalon.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Haplochromis (genus), Haplochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIRMMGTGGVVSLPDEANAQIQERLRPYNIINDDSSHFD
  • Length:  46
  • Propeptide:  MEAGSRVIMQVLLLALVVQVTLSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPDEANAQIQERLRPYNIINDDSSHFDRKKRFPNN
  • Signal peptide:  MEAGSRVIMQVLLLALVVQVTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006541_AF2.pdbhor006541_ESM.pdb

Physical Information

Mass: 585041 Formula: C214H342N62O75S2
Absent amino acids: CKW Common amino acids: DEGIS
pI: 4.06 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 14
Hydrophobicity: -41.09 Boman Index: -9799
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 84.78
Instability Index: 3812.61 Extinction Coefficient cystines: 1490
Absorbance 280nm: 33.11

Literature

  • PubMed ID:  1944299
  • Title:  Characterization of complementary DNA encoding the precursor for gonadotropin-releasing hormone and its associated peptide from a teleost fish.
  • PubMed ID:  9748399
  • Title:  Genomic structure and expression sites of three gonadotropin-releasing hormone genes in one species.